DPCstruct | MC44593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VPU9 | 2-83 | GRSAAACGNIGLPALDAMRQTPRVDILCAELSSFQLHWAPSVAPDAGVVLNIADDHLDWHGSFDAYAEAKGVALRGAVGVVG |
| A0A6N8PN67 | 2-74 | GVSVGVGGNIGLPALMLLDAECELYVLELSSFQLETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIY |
| A0A376YGD6 | 1-99 | None |
| A0A2M7MHR4 | 510-602 | None |
| A0A535J4A4 | 88-174 | None |
| K8AVJ7 | 261-362 | None |
| B6WAW5 | 118-210 | None |
| A0A511MGT5 | 135-212 | None |
| A0A2N9GJD6 | 1-112 | None |
| A0A521SK88 | 117-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.