DPCstruct | MC44589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3SGU4 | 35-118 | KRTIIVRSESGIEREHLVSHGQRLRVHSGDYVRAGEPLVEGPQVPHDILRISGEEAVQQYLLREIQSVYRAQKVDINDKHIEII |
| A0A6G3VJQ6 | 1-77 | KRQRLRVFKHDDGSERLLADGDHVEVGQQLMEGAADPHEVLRVMGPRQVQVHLVNEVQEVYRSQGVSIHDKHIETIV |
| A0A2E7WET4 | 28-87 | None |
| A0A1G1GV03 | 95-180 | None |
| A0A149SAP5 | 21-83 | None |
| A0A0N4ZJN7 | 37-115 | None |
| A0A849UBL1 | 58-141 | None |
| R7G3L2 | 1-58 | None |
| X7XYS7 | 1-96 | None |
| A0A831YD26 | 79-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.