DPCstruct | MC44587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5CPQ1 | 2-76 | LLIDERPEEVTEMSRMVQGEVVSSTFDEPATRHIQVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPAS |
| A0A6G3VGP5 | 1-80 | CHLMVVLVDERPEEVTDMQRSVNGEVIASTFDRPPSDHTSVSELAIERAKRLVENGRDVVVLLDSITRLGRAYNNASPAS |
| A0A3E1E0Y9 | 102-194 | None |
| A0A402W8A8 | 187-274 | None |
| A0A6G2JCQ7 | 291-388 | None |
| A0A1U8N4M4 | 513-606 | None |
| A0A1H6KMR0 | 381-475 | None |
| A0A3R7UMF9 | 323-414 | None |
| A0A369L637 | 502-595 | None |
| A0A1M3LG61 | 313-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.