DPCstruct | MC44583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VE17 | 1-75 | RLAREESGRVLALLAARFDDVDLADDCVQDALLQAAETWPTRGVPDNPPAWLYTVARNRIVDQLRLRASRRRRLS |
| A0A561RWK1 | 7-82 | TVEAVYRIESARIVAGAARIVRDLAIAEEIAQDALVAALEQWPETGVPDRPGAWLMTTAKRRAIDLVRRKETYARK |
| A0A0H3D8Q1 | 1-93 | None |
| A0A1Q7AWD3 | 38-116 | None |
| A0A6F8XW24 | 29-100 | None |
| A0A846YZY4 | 114-195 | None |
| A0A5D0MSQ4 | 2-91 | None |
| A0A2V7C6W8 | 5-89 | None |
| A0A498PNL5 | 4-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.