DPCstruct | MC44582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VE13 | 5-92 | LIENTAGGDHAMARTLEAIDRLWESVGDFDQAGFCLDTCHAWAGGEDLVGLVERVKGITGRIDLVHLNNSRDEFDSGRDRHANLGDGH |
| A0A379UUS0 | 50-151 | IENTAGQGSNLGFEFEQLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPEACEKTFAEFGKIVGFQYLRGMHLNDAKSAFSSRVDR… |
| A0A842Z070 | 156-237 | None |
| A0A0D8Y043 | 195-298 | None |
| A0A7C5U7A7 | 13-107 | None |
| A0A2P6P0P0 | 257-349 | None |
| A0A2C9JFR1 | 1040-1135 | None |
| A0A7R9PTU3 | 55-153 | None |
| C4JG04 | 66-160 | None |
| R5Y6D3 | 38-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.