DPCstruct | MC44581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VDZ9 | 9-78 | SMLPAKRDSAYSGWVSVSVGCNNTCTFCIVPSLRGKEVDRRPGDVLAEVQALVDQGVSEVTLLGQNVNAY |
| A0A538TZA6 | 149-215 | RALSTPRHLAYLKISEGCDHRCTFCIIPRLRGDQRSRPLAELVAEARRLAALGVRELVLIGQDTTGY |
| A0A182TEM4 | 173-234 | None |
| A0A261DBM9 | 382-448 | None |
| A0A7C6N901 | 80-148 | None |
| A0A3D3GBH0 | 213-294 | None |
| A0A2W1BYK8 | 197-257 | None |
| A0A6J1WUW8 | 221-281 | None |
| A0A645J1B7 | 75-138 | None |
| X1W0K0 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.