DPCstruct | MC44578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3ZIV2 | 216-304 | HILALREGREPLETKPDVCWQLPVRRTYDWVERPDGTQILQVSIGEYDRRGWGPGGHDLHWWCTSATSAHGAGEPVYVSYRPELTEL… |
| A0A6G3VCC5 | 1-89 | HSMALRRGLEPLTVKPEVCWQLPMRREEDWVERPDGTEVLQTTITEFDRRGWGEGGHDLQWYCSGSPDAHVGATQVWESYAPELTEL… |
| A0A6J7RCF6 | 2-90 | None |
| A0A6I3F4W5 | 4-93 | None |
| A0A1V5JB68 | 143-236 | None |
| A0A6I3GCF9 | 58-139 | None |
| A0A127NTH6 | 91-187 | None |
| A0A7C6U830 | 53-163 | None |
| A0A7Y2GKW8 | 159-249 | None |
| A0A6I3ADB3 | 130-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.