DPCstruct | MC44577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VC71 | 2-90 | ANRFGYVVEVDPHDPASTPVKHSALGRLKHESATIHIVSSGPDTGTVVAYSGDDERFEYIYKFVSSRRMKTGLSSTARTHNLGILDE… |
| A0A774NA18 | 217-299 | PNEPNRFGWVVEIDPYDPHSVPRKHTALGRIKHEGAAVTIAPDNRVVVYMGDDQKFEYIYKFVSEGKFNPQDRKANMHLLEKG |
| A0A090RWZ5 | 3-96 | None |
| A0A2E3NK80 | 427-513 | None |
| A0A4R7AA80 | 327-407 | None |
| A0A0B8P5K2 | 21-118 | None |
| A0A7U2UUP0 | 107-200 | None |
| A0A286P3U0 | 143-223 | None |
| A0A522DD55 | 270-354 | None |
| A0A1H1QUW4 | 161-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.