DPCstruct | MC44576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.32 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0617- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KKP9 | 1-126 | QEEHPKLSDEELYRYAKLVTSAVIAKIHTIDWTVELLKTKTMRAAMRANWYGLLGKKIKDTFGHIGGTALGGLVGLKKPINHGVPYS… |
| A0A6G3VB00 | 1-139 | YPFMTDQQLYDTARLVNTALMAKIHTIDWTPAIIAHPTTVSAMRGNWFGLLGERFARRFGRVADSEVLCGIPGSTTNHHGVPYSLTE… |
| A0A6A6MA32 | 175-299 | None |
| A0A1L7XC50 | 260-399 | None |
| A0A4D9BTU0 | 322-457 | None |
| A0A6N2KA61 | 41-158 | None |
| A0A2G3D9A6 | 12-105 | None |
| A0A5J5BJE4 | 78-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.