DPCstruct | MC44568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 209 ± 41 aa |
| Standard deviation of domain lengths | 41.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3V3U1 | 2-186 | VAFSVAGLFDNPDLLLEYTTDPVGPGTRDASLHATGDTEMIDPGPRPSWRNARVTTDSLPDDITAVRIVATDENLSEDRFIVVTPPR… |
| A0A656KTX5 | 1-181 | MVSAAGRFDPREVQVQWATDEQAASGHPGGSFQFADVGASPAWRNLRLPLSAIPAAATQVRLVADDEDLAPQHWIALTPPRIPQLRT… |
| A0A2S6IU40 | 771-959 | None |
| A0A399TKF5 | 32-266 | None |
| X7Y9N3 | 296-523 | None |
| A0A7V9T9V8 | 644-880 | None |
| A0A6G3VMN3 | 1-140 | None |
| A0A6G3V7D1 | 2-137 | None |
| L7KNX2 | 17-213 | None |
| A0A0M4PUW5 | 118-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.