DPCstruct | MC44565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S0WY38 | 36-150 | PDVFRDKVVLLPCDDPEWSNFTKFFALHFMDFGLKKLISTSLAPDAKPAKTPARDKYAPTLFELEDPRFDPTKTRLNGKLFVLDSTD… |
| A0A6G3UYX5 | 1-111 | PDVFRDLTVLLPCDDPEWSNFAKFFALHFHDYGLKKLIATSYAPDSNPGLPAYQPTLFETEAPQFDETKTHANGKLFVLDRDVNGDG… |
| A0A1I7IFI2 | 100-192 | None |
| A0A412RU67 | 49-165 | None |
| A0A2X2EET5 | 94-198 | None |
| G7GLT9 | 47-157 | None |
| D4YSX0 | 1-97 | None |
| A0A558IJF1 | 36-152 | None |
| A0A1V0JE27 | 37-124 | None |
| U2GUV8 | 34-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.