DPCstruct | MC44561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 145 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A261XTV6 | 1-141 | MGRKDLKTIVLNFAPSWSAVTMGTGVLSLILYDAPHQFLAETYIAIAVYAFNIVLFLTFLGRSIARILCFPWVVKRIRIHTASLVYL… |
| A0A7W5SCP7 | 13-144 | KPLSRLDSPREMIRQFTPNWFAATMGTGILALALPQVPGVGASLHPVGEALWYFNIALFTLFAGLYTARWTMFGHEARRIFGHNTVS… |
| A0A179GQC1 | 350-491 | None |
| A0A2S5TPR9 | 3-134 | None |
| A0A7C8H2Q7 | 135-283 | None |
| A0A1V6TI19 | 18-152 | None |
| A0A2V1DCA6 | 73-213 | None |
| A0A2L0HU26 | 1-146 | None |
| U1I466 | 3-132 | None |
| A0A179TXJ7 | 440-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.