DPCstruct | MC44560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 183 ± 26 aa |
| Standard deviation of domain lengths | 25.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 11.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7V305 | 27-219 | AATSAKLRQVRAELAAAQAQLAEYRVQFGYVDISDPSKLHAACIPTTTPWLWMWRVYVPAEGRWKLRFQTNQIEPHGFSGDLGGSMP… |
| A0A1Y3RYX7 | 80-260 | KLLLLVLTLTLAAGLCGCEKGLEPMQLQAAPVSEETRQVLDLIDDELTLWEYRLNDGAYTMVVDLWVCQDGSWEKTNLLTGPAAGQA… |
| U2J047 | 10-228 | None |
| A0A5C5ZDR2 | 92-331 | None |
| D2MLV1 | 10-169 | None |
| A0A2S8F8G7 | 3-208 | None |
| A0A2S8FQP4 | 276-491 | None |
| A0A5B9M5X0 | 34-252 | None |
| A0A4U1ML98 | 1-139 | None |
| A0A6L4Z6B9 | 9-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.