DPCstruct | MC4456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 102 ± 19 aa |
| Standard deviation of domain lengths | 18.66 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9D4I0 | 7-112 | GLSNCVQCGKIYLRITSAFCPDCLKQDRENLENVRDYLRFNRGASMEETVSDTGVDPGRIVAWIQAGHLMLSPQSAIKYPCENKCGS… |
| A0A7C4L6T0 | 1-100 | MLKNCERCGRVFDQEGNEDLCPECYLEDKKELKKVRDYLNKSPLASVMEVCEKTGVSQSQILRFLKEGNLKIRKPLEGFKCRLCGKP… |
| A0A4U7JGT8 | 1-77 | None |
| A0A4P6ET83 | 1-79 | None |
| A8MJQ5 | 2-85 | None |
| A0A5C8NV19 | 3-110 | None |
| A0A7U6KHJ2 | 3-110 | None |
| A0A1V5I7P1 | 2-113 | None |
| A0A1D9P5P3 | 7-117 | None |
| G7V5K2 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.