DPCstruct | MC44559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 189 ± 32 aa |
| Standard deviation of domain lengths | 32.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1YM81 | 28-209 | CEPWVESFAIIGQLQLLRCMISLKLSSSRKVLNKQGMLSAFCSPFSSIYMRKDSPPFLSRCMSIVTISQLSHYVFDPHLSTLTCQVK… |
| X6NZU8 | 14-183 | LHDIKAHYRQPTKPYPNDDNPVLGNLDKLLDFVGISNPMAKIYVTSDPLEGLATLLFFFVVATIERLQWFPEFNTLALVSNKGKEVL… |
| A0A1B6PKH3 | 129-346 | None |
| A0A058Z0P3 | 493-707 | None |
| A0A482WZF8 | 17-150 | None |
| A0A5N5T6X5 | 43-221 | None |
| A0A4V4H897 | 362-557 | None |
| D3BMK3 | 651-874 | None |
| A0A7S3AUP6 | 231-449 | None |
| A0A182SYK9 | 460-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.