DPCstruct | MC44553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 57 ± 2 aa |
| Standard deviation of domain lengths | 2.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 96.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 69.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3F1T4 | 1-61 | MQSEAGAAGSFHGSLQAGALTTTYTASQGLLLMVPNMHKIAGELLPGVFHVSARALLVHAL |
| A0A4R6Q3S9 | 64-121 | MESEAGAAGTVHGALTSGALTTTYTSSQGLLLMIPNMYKIAGEMLPAVFHVAARSVST |
| A0A2C9KDX5 | 22-79 | None |
| C5LEU8 | 89-146 | None |
| T2JPL5 | 62-119 | None |
| A0A447KY79 | 26-79 | None |
| A0A813AYB1 | 122-182 | None |
| A0A2X4TBV2 | 26-83 | None |
| A0A4U9CVI9 | 22-76 | None |
| A0A7X6AAS5 | 2-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.