DPCstruct | MC4455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 180 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1NHJ1 | 5-168 | TICIICEKDAEKSGVQGKDGYLAECATCGKYFLASPELFEGSYTGMPREKKAMISAYTRERFEHGREPPVLGYPDEDIITEYENKIA… |
| A0A7C4FRD1 | 7-176 | CPACRSISEIENAKIDGTIAIVYLVNCPRCGKYQIDYVARDYLNVDLDTTKTAVLSHAIRVLHKKIEIPFLDQITVARLLQGPLPKP… |
| A0A1F9BB10 | 1-178 | None |
| A0A2W4C5C7 | 15-197 | None |
| A0A699MDE0 | 178-357 | None |
| A0A2N2N9E8 | 71-241 | None |
| A0A533BDS6 | 2-191 | None |
| A0A0A7LQ36 | 11-195 | None |
| A0A7V1HDD5 | 3-199 | None |
| A0A7R9NFZ5 | 10-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.