DPCstruct | MC44542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645JKU5 | 1-76 | MGWAAVLMIKPLLATVAVEGLYWLIGGGLLYTVGAVFYLARRMPFNHAIWHIFVLGGSIAHFIVVFKYILPIAVID |
| A0A3N1PCM7 | 138-209 | STAIYVAMGWLVLVAIKPMSEALTSMELSWLVWGGLFYTLGTIFYMFRRIPYGHAIWHCFVLGGSVCHYAAV |
| A0A656AXV2 | 92-166 | None |
| A0A833DFC7 | 25-92 | None |
| A0A7C2M257 | 9-79 | None |
| A0A317EVZ9 | 1-74 | None |
| A0A1V5FR64 | 43-118 | None |
| A0A7S0M4Z9 | 21-105 | None |
| A0A7S2U8G6 | 61-128 | None |
| A0A1B2YNF5 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.