DPCstruct | MC44541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 129 ± 17 aa |
| Standard deviation of domain lengths | 17.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09709 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645JEV7 | 1-121 | MIKEQNDPNDTSPAIVCGKIFAVMEGIQRAAQGKDLNAGIRERFFSFASTSPAPAFGRLMKLSQNHISKLKHEKPGLAVLLDRQLQE… |
| A0A1V0V0B1 | 2-105 | EREQKFGRLLAVADILGIRVFESGKPSPAEAHMDRFGRRPADTFNRIHKNIMEYSYKFSQKELDLLSKLDEIMNSFDYEQFNNKPLA… |
| A0A847W146 | 4-159 | None |
| A0A0R1NUD7 | 766-884 | None |
| A0A7C7ZAI4 | 63-191 | None |
| A0A7X4DW57 | 62-211 | None |
| A0A369TA45 | 493-634 | None |
| A0A7C6LWP8 | 147-270 | None |
| S9S0V0 | 601-722 | None |
| A0A420Z295 | 109-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.