DPCstruct | MC44536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 192 ± 26 aa |
| Standard deviation of domain lengths | 26.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.49 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0436- CL0036- CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A359LRC8 | 12-192 | QATGPVLKQQVLSASEQAQRILAEASAERERVRAEAFEAGFRAGLAQWETAIAAAQRSVHAFIEESRPSLLKLAVRIAEKILGEEVR… |
| A0A0K1JVP5 | 194-402 | AARETALARREEEVSALRARLEKQEAELAAARRELDGQAAQRLADAEQRGQAQGQERALQEAKEAAQKAQEAAAQRLAALDAAIAAF… |
| A0A443ZGM4 | 2-180 | None |
| A0L4A5 | 35-236 | None |
| A0A212CD21 | 1-131 | None |
| A0A6A4JZ25 | 11-234 | None |
| A0A2X2CSX6 | 6-180 | None |
| A0A7K4HFD5 | 3-158 | None |
| A0A5J4YYV0 | 7-217 | None |
| A0A2K1J527 | 7-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.