DPCstruct | MC4453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6ZYP4 | 8-127 | VDGCIAGGRRYLHINAAGDIEPCAFIHYADSNVREKTILEALKSPLFQQYRKNQPFNCNHLRPCPLLDNPACLAAMVHASGAASTEL… |
| A0A7C4BMJ3 | 10-127 | LVGGCIAGGRRYLHINSKGDVEPCVFVHFAVDNIKNKSLKEVINSPFFKDIRERQKANNENPLLPCMIIDHPETLREVVSSHNAYPT… |
| A0A7C5EQ64 | 1-137 | None |
| A0A7C7D1L3 | 104-228 | None |
| A0A1G9RPW8 | 334-458 | None |
| A0A7X9EEE6 | 77-205 | None |
| A0A0F9HI33 | 31-138 | None |
| A0A645EP22 | 2-122 | None |
| A0A7X2PCN0 | 30-160 | None |
| A0A497DK55 | 28-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.