DPCstruct | MC44529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 280 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8MK62 | 22-289 | KDYHGIYTALSRSATAAGTVILQGFSPAKITGGIRGSLRQEYRELELLDDITRLRYNGNLHKSVYGDCRNILIKSFRTWKGQDYVPK… |
| A0A409X8R3 | 527-801 | KDHMSYYTCLSRSSSADSTIILHAVDAKKITRGISGHLRQEFRELNILDEVTRLRYDGILPHSVIHTLRNPTIRAYMLWNKSSAIDS… |
| A0A2H3EA12 | 57-362 | None |
| A0A284RJB9 | 325-623 | None |
| A0A284RHC7 | 277-569 | None |
| A0A0C9WHH9 | 143-427 | None |
| A0A0D0BPE1 | 1-217 | None |
| A0A165B4H6 | 118-393 | None |
| A0A550BTW5 | 5-305 | None |
| A0A6A4IA68 | 166-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.