DPCstruct | MC44528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 73 ± 3 aa |
| Standard deviation of domain lengths | 3.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265- PF04676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803YKH8 | 1-74 | MFEAKGLDCVFIETNMSMKKRYHMVYECIPLPKEVGDMAPIYFKKAIMESDEEWSMNKKIIDLSSKDVRKSVPK |
| A0A444TEN5 | 132-198 | FSENDEDCVFFETATRLHQTPHMVIQCVPMPKETGELAPIYFKKAILECDEEWAQNKKLVDLKGRNV |
| A0A2N5TJS0 | 1-77 | None |
| A0A4W5LKM9 | 1-75 | None |
| A0A1C7N4T0 | 123-191 | None |
| A0A7R9PSJ0 | 1-75 | None |
| A0A3P8WTT8 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.