DPCstruct | MC44520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 165 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3WWN2 | 1-154 | MFITLQTTCAYLSIFDMLYWDSRCLTIFTGWVWLVWLLTLDALTPKVRALMKFKNWYAAPVLLFSISVQVFITEQVVNSTSIDIQDR… |
| G4ZX38 | 235-387 | FLLFQIVAIGVCVVDMLSWRWHCACGVMCSGVLAFTVLTIDALTPVMKQRLRFNYWMVVGGIVLFWLVQMELLLDVLVLGQLDLKDR… |
| A0A6A3Q2X0 | 1-156 | None |
| H3HBM6 | 344-517 | None |
| A0A5D6YBR5 | 228-396 | None |
| A0A5D6YL66 | 829-1013 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.