DPCstruct | MC4452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16017 |
|---|---|
| Mean domain length (aa) | 309 ± 95 aa |
| Standard deviation of domain lengths | 95.33 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.89 |
| Pfam Score | 67.82 |
| Assigned Pfam label(s) | PF12309- PF08492- PF18972- CL0003- CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4VAP0 | 21-324 | KKLIAEGIDVNSKEKYGWTALMLASTRGYLDCIKELIKAGANVNAKNENGWIALMHASYRGYIDCVRALIKAGANINVKDKDGSTPL… |
| A0A7C4BM93 | 27-295 | KKDAKSIETRRKLAEIYVKLGNTDLALQEFDNIIKINPKYIHSHNYKGFIYSDQGRWDLAIKEFESALKIDPNNLYALGHLGLAYRM… |
| A0A378BJY5 | 29-361 | None |
| A0A377ZYF7 | 11-316 | None |
| A0A2V4DYP6 | 10-341 | None |
| A0A2J8AGW2 | 41-447 | None |
| A0A2J8ADU2 | 14-160 | None |
| A0A7Y3PL47 | 214-590 | None |
| A0A2D2CZJ2 | 577-793 | None |
| A0A136PMJ2 | 22-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.