DPCstruct | MC44519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 196 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3WSC9 | 18-220 | CTQPAKPGYAYCCAAHDPTHSAAFSPEDFGKYGLRSLKKSAIVELYNGKDPYHEAELPQDIDKKSYHLDHIFEKQMFAYAFECVAKG… |
| A0A7R9VYF7 | 3-163 | FRKSVTYKLDKVWTNNSNKDLFTGWWRRKLEDEHHPHVDHIVECQLGEHIWNQALDGRMTTRTRLAKVTKLWNDVDNLNVTTNWLNQ… |
| A0A5C3LSH4 | 42-245 | None |
| A0A819YPM4 | 41-252 | None |
| A0A6G0RS76 | 192-406 | None |
| A0A662WXZ3 | 15-241 | None |
| W2YS21 | 150-335 | None |
| A0A482SSE0 | 136-305 | None |
| A0A0D7AK90 | 31-212 | None |
| A0A0D7AC56 | 12-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.