DPCstruct | MC44512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 192 ± 49 aa |
| Standard deviation of domain lengths | 48.56 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3WH62 | 16-160 | AAAALASAVSSSSSSSADSPLGAWYTEQIGANETQLIGLTSATLQHLVTDDAVELPCAGRPSTQSITVLPDGSRWTNDGCPSLFTSL… |
| A0A484E024 | 3-144 | DVESDVGIDDQVKAWLENYMADGETRLFVNDIKSVWSDTIGSSLTANWKALPVVCEGKPSVQTKASTVPPNGGCPEVYTKANVSCTC… |
| M4BA18 | 109-282 | None |
| K3X7Q7 | 136-315 | None |
| K3WH60 | 2-169 | None |
| K3WH61 | 21-202 | None |
| K3WH63 | 67-244 | None |
| A0A5D6Y878 | 1-241 | None |
| A0A0P1B4N9 | 259-503 | None |
| D0NW69 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.