DPCstruct | MC44509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 167 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833SQB1 | 1-153 | MMKCFSLLTAVAFALTQSVVDGALSVTSTEPTRSNNGPFLEKVWIIEGDAGDILDDLKVQVAGNVFVDYDASLAADGKVAARVIMRS… |
| K3W940 | 2-189 | VTDYVPMPKSTTRFLLFFTVVTFLCGSHPALNQSGDEQLAGFTIVSAATESVTAGKQQGVNDLFARKWEVQANGATNATVIDKIDLT… |
| H3HCI5 | 739-913 | None |
| A0A421GSX3 | 308-486 | None |
| K3X9I3 | 1-168 | None |
| K3X9H7 | 1-145 | None |
| K3WQJ7 | 68-231 | None |
| K3W952 | 1-194 | None |
| A0A5D6Y090 | 1-158 | None |
| A0A662XR91 | 385-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.