DPCstruct | MC44506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1699 |
|---|---|
| Mean domain length (aa) | 236 ± 54 aa |
| Standard deviation of domain lengths | 53.90 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.04 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | PF13475- CL0238- CL0063- PF07830- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4PP31 | 44-261 | MLCGVYDGHFGRQASEWVRILLHLLILSDPEFESNPKDSFIRAYTDIDFFINLQAESAGWAPGSTALTALFYDDKILLANVGDCQAV… |
| A0A7G9PJ42 | 2-158 | NCGDSRAVLYSGGEATFSTRDHKPVLPAEKERIINAGGSVMIQRVNGSLAVSRALGDYEYKNVEGRGPCEQLVSPEPEVFVRDRDDK… |
| A0A7S4UQK5 | 299-577 | None |
| A0A811N0U0 | 15-187 | None |
| A0A3D2C744 | 89-351 | None |
| A0A2J8AJN7 | 365-511 | None |
| F4PHF0 | 596-869 | None |
| A0A4Z2HFC4 | 4-228 | None |
| A0A7C7QSE1 | 17-194 | None |
| A0A811M9R3 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.