DPCstruct | MC44505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2DDP1 | 311-467 | LPTSVRLILTSFPSLFGSETATELRKLCASHGWALGWALGINEAKGLGSKAPVKWRVIDPEVFSYNGSVGVHMDAPLVGHALLSTRL… |
| A0A813CMX9 | 308-453 | FPHAVKHIIGNFPALFGTDDGRRLQRIAAERSWPLFWAVGDGKLTHLAIDTNPTPYRCNERFADPAVGTITNASIPWASEQVFDKVW… |
| A0A1Q9D9Y5 | 668-829 | None |
| A0A1Q9ENQ7 | 428-591 | None |
| A0A1Q9DR04 | 394-558 | None |
| A0A812X334 | 144-309 | None |
| A0A812VUQ8 | 905-1052 | None |
| A0A812MAE3 | 394-559 | None |
| A0A7S2G6C6 | 95-289 | None |
| A0A0M0JHJ9 | 237-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.