DPCstruct | MC44503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 278 ± 41 aa |
| Standard deviation of domain lengths | 40.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4P396 | 276-541 | LQIYTEFTLEYGLGEELSYNFGAIEQYLMDKVLLGKPFVDLELRKFSFANEARMTGALNVIKQRITQIELAPNVKDNIQKELAESPQ… |
| A0A7S2SAQ6 | 7-217 | GQLRLLATRVPQDQLPPSVVEAILQEVDTKQRLTRLQTLVEDAVRFAVGVGGGAVKAMDGSTLFHRYATEVLLMDPDLWRRTATPSI… |
| A0A821PUE4 | 450-768 | None |
| A0A2I1ETM9 | 277-518 | None |
| A0A812UKI8 | 68-320 | None |
| A0A1X7THX8 | 259-435 | None |
| A0A820YHU9 | 12-249 | None |
| A0A820QWS5 | 15-384 | None |
| A0A820N8L1 | 46-327 | None |
| A0A818F879 | 187-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.