DPCstruct | MC4450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2GC61 | 1-112 | MKCLECGEKIIGRSDKKFCNDACRNAYNNKQNKDSSNLMRNVNNKLRRNYRILSDINLEGKTKIAKSKLSGLGFDFNYFTQIKVYKN… |
| A0A316JRA7 | 1-128 | MAHEILQLGGPHLKACKCCGLEFYGRRNQKFIDTTHKANYNNQKNAVKREKLSPVFKKMATSYYVMENCQRRDMLDRWIHITDLIKE… |
| A0A353VTH5 | 1-96 | None |
| A0A352FD81 | 38-153 | None |
| A0A3S9PBA2 | 3-123 | None |
| A0A1T5H404 | 80-194 | None |
| A0A0Q4FQU7 | 1-95 | None |
| A0A2E6GX29 | 16-145 | None |
| A0A1G0C546 | 18-136 | None |
| A0A162NTD1 | 53-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.