DPCstruct | MC445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 290 ± 37 aa |
| Standard deviation of domain lengths | 37.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 13.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5VX97 | 386-736 | QMVLINHFYENTFLHDNASITISKPAFNLIDHVPEWSVYDFLKHLCNLFGMGYEVDNQTSSIEFHFLEDILTTDDYIDISHLVIGKI… |
| A0A497CFB6 | 2-289 | PEIKIIDFLKGLFDMFKLVVIAQDDGILYVNTLNNYYQEGFNYDLTNYINFDTYDANRGELLKEIEFKTVSPTTNLAIQFKENNNTP… |
| A0A7G2RQ84 | 381-744 | None |
| A0A519T5E6 | 11-268 | None |
| K1UXH4 | 311-538 | None |
| A0A4P8LST5 | 659-937 | None |
| A0A2D8XMT0 | 426-719 | None |
| A0A0P0M3K5 | 31-260 | None |
| A0A6S6T5K5 | 471-769 | None |
| A0A3P1BZ50 | 7-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.