DPCstruct | MC44488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 486 ± 98 aa |
| Standard deviation of domain lengths | 98.33 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6WDZ0 | 2-454 | DWRAERAALDEYIEQLGMQPSYVPRPGEVVLWAPEYQGELAWNHETKRVEVYAPDQNEWLGTPAWRAGIVGQTPEEDTVLQDLVITA… |
| A0A0G2FCS9 | 129-446 | TLFRRGEMVWFQQGPAWRIGVIRQVGAGQMPGYVVIPLAHSVLNLADVPKQQHEMRPFLTFSVPAISIPDLQNRTFPQIDWETLLKM… |
| A0A6V8H9M0 | 21-505 | None |
| A0A232LZN1 | 65-608 | None |
| A0A6A6B6R8 | 138-676 | None |
| C4JVN9 | 85-533 | None |
| A0A438MU15 | 529-1153 | None |
| A0A022XXN6 | 1-472 | None |
| A0A0N1HDS3 | 125-817 | None |
| A0A3N4M2R0 | 76-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.