DPCstruct | MC44485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 358 ± 51 aa |
| Standard deviation of domain lengths | 50.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | CL0020- PF19311- PF19314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4V5A2 | 1-320 | LSQCVHQLWLVDVLQPQLLNTCEQVVLVSTSVLCAAVRLVQSSSLLDQLVHFLLRTHPLTHLLLQRCDHISDQISMASLSLVEELLQ… |
| A0A0A9Y5N7 | 96-431 | VREIVEKFLSEVFTDDVLSQPLAITILGKLFKVASSSLLNKALSEWLVGESITREALNSKKTTTLQTLLSNWSCQRTDLVLETLRFF… |
| A0A024G955 | 270-761 | None |
| B5DFN7 | 1-383 | None |
| T1HB05 | 755-1095 | None |
| A0A444TXV9 | 437-785 | None |
| A0A0S7G1G5 | 209-563 | None |
| A0A0L0HT58 | 321-672 | None |
| A0A0J7KYS9 | 848-1210 | None |
| A0A671YXU8 | 239-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.