DPCstruct | MC44483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 77 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4UV57 | 15-97 | PTHRSAFIFSQNTSRMSSSSNLVAMKKVVQQLRFEASIHRVKVSQAAADLQQFCIQNALQDPLLTGVSSSTNPFRPQKVCSFL |
| A0A5E4D8J8 | 1-59 | MSSGASVSALQRLVEQLKLEASVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPF |
| A0A7N4P7V0 | 61-147 | None |
| A0A674H427 | 132-220 | None |
| A0A4U1FCB4 | 236-319 | None |
| A0A665U1I8 | 1-61 | None |
| A0A0V1EXA1 | 26-121 | None |
| A0A670K8V8 | 195-265 | None |
| A0A315V8Z0 | 135-222 | None |
| A0A3Q2UHW3 | 309-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.