DPCstruct | MC44481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 187 ± 30 aa |
| Standard deviation of domain lengths | 30.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849ITQ6 | 292-495 | NLVQSLADVEWNSLGSLSYQATLKATHPFASPFYSWPLDAHPVLFYATYSGNGVSTVGGQTVSNYAWISDMGNPAIFWLGMLALAWC… |
| A0A7K0WEA7 | 9-192 | FIYYHQQMLDFHTGLNEKHTYQANPWSWLVMGRPTSFYYESPKGCGADSCSQEILALGTPLLWWLGTIAVVVVFGLWTRSIAKRRLD… |
| A0A5K1K408 | 188-381 | None |
| A0A2P7AGK1 | 172-369 | None |
| H1W0R0 | 306-505 | None |
| A2DR01 | 4-150 | None |
| A0A6S7IF72 | 24-238 | None |
| A0A653PMK5 | 7-160 | None |
| A0A6L5G2V9 | 22-197 | None |
| B4DSA5 | 364-563 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.