DPCstruct | MC44480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 226 ± 42 aa |
| Standard deviation of domain lengths | 42.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4HWB7 | 19-246 | ALVFLVLMWLAQVATPLFERGQRQAPTTAVVVLLAASALCAAAASVGWWRALVAVTAATAVGFAVEAVGTRTGLPFGEYRYSGALQP… |
| A0A849IHL5 | 19-228 | PWVLVGVIVWRCFGWRRAVLWLGVGWALAFAAEWSSTSGPGIPFGVYHYHPGGLSHDWTLLGVPLFDSLSFGWLAFCTYAVMGSLGA… |
| D7CS25 | 252-471 | None |
| A0A662E566 | 23-317 | None |
| E3J0A8 | 95-350 | None |
| A0A3G8YEM1 | 260-489 | None |
| E8U4M4 | 75-316 | None |
| A0A044SLY4 | 11-334 | None |
| A0A2M7UG87 | 5-202 | None |
| A0A3P3RMV3 | 30-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.