DPCstruct | MC4448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 199 ± 34 aa |
| Standard deviation of domain lengths | 34.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 65.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834DEP3 | 1-139 | MATPKPRILPWLVSQLDGGHLEGVAWLDPSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEASGAYTPGKDKPDLPTWKRNFRSALNRK… |
| A0A556V8H2 | 5-183 | GRRLKQWLIEQINSNIYSGLLWEDEVHTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFE… |
| A0A6I9Y9L0 | 55-198 | None |
| H0YV95 | 112-300 | None |
| A0A3M0J7F0 | 132-381 | None |
| S9XQQ4 | 866-1010 | None |
| A0A7I8VTN2 | 211-365 | None |
| A0A6J0V6G8 | 5-205 | None |
| A0A3M6V3K3 | 3-256 | None |
| A0A7J7KSB4 | 1-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.