DPCstruct | MC44474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 180 ± 14 aa |
| Standard deviation of domain lengths | 13.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2HU99 | 1-170 | AAEADEVFREEMRQRFNEPWRTLLGHMRHESGHYYFGEVVGDSNREAARALFGDETSNYSQALDHYYNNGPLPNWNERFISAYASAH… |
| M2AYV9 | 62-233 | AEADSVHRERLRVKLGEPQRTLIGHMRHEVGHYIDWAWASRVAPAKYHALFGDPNTLDYGEAMKKHYAVGAPANWADRHVSAYATMH… |
| A0A258B7B6 | 2-149 | None |
| A0A2P8KF45 | 209-399 | None |
| A0A4Q2XTL8 | 98-275 | None |
| A0A6N2DGU2 | 291-466 | None |
| A0A0S8EYM3 | 165-336 | None |
| A0A378UAM5 | 327-510 | None |
| A0A257XYK3 | 51-248 | None |
| A0A249P0K5 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.