DPCstruct | MC44471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 218 ± 43 aa |
| Standard deviation of domain lengths | 43.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0F4H0 | 15-247 | GLKEIKRYYQKLTWASTTFALLTDLALFCYGGNLKRREKITGRFADILSWLYLVTATLRRFEAEGQPPNDLPLVHWSVQYAFAQIQD… |
| A0A6N3QRG2 | 377-611 | LTSSTPTGDATKRYYQHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNEADLPLVHWGVQDA… |
| A0A7C5PTJ4 | 2-169 | None |
| A5EY58 | 367-591 | None |
| A0A656SH34 | 19-205 | None |
| A0A6S7DHK1 | 5-187 | None |
| A0A655WB46 | 64-308 | None |
| A0A7S2XPK5 | 42-268 | None |
| A0A109LK64 | 2-182 | None |
| A0A3M1HSY9 | 219-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.