DPCstruct | MC4447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 255 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653D309 | 171-423 | RVHLKCESIRMKLQVVDDRENLCQVEPYHTTLCLFDAKNNRKLTENFHFDVNSASIRSTFNTSIVTWDPNKLELPSNLPSEWLLYPK… |
| A0A556V895 | 7-257 | VKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFHFDLNSDQIKGMLRPHNPHIAISTLARSAIFSITDPSPDIFLVIKGDIGECCE… |
| A0A3P7M2E5 | 72-312 | None |
| A0A139AY66 | 307-546 | None |
| A0A044SZE1 | 423-693 | None |
| A0A0C2IWQ6 | 384-606 | None |
| A0A0D8XDN4 | 413-670 | None |
| A0A455B8X4 | 267-578 | None |
| A0A553P9D5 | 1-237 | None |
| A0A7F8QAS3 | 100-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.