DPCstruct | MC44459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 365 ± 53 aa |
| Standard deviation of domain lengths | 52.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2ZLJ1 | 430-827 | TLVQLEMNIEREAQGRSRGLQKAKSRCQELAATIHDYLHQVGDLYNGDPAQQSVKVLCVFELWMRMDECAIVCCPLLANYRPIFDPR… |
| A0A812K2G4 | 6-345 | DRHACINFPMLRGHKVGVDMGMLSRLLVPLPSHRRLLDSLEKYVWSRDEKATYPATIEPNVSSASFAVRFHSTSNDAEKVRLDILEQ… |
| A0A0D2IR68 | 126-475 | None |
| A0A2U3E0R9 | 728-1097 | None |
| A0A7S8D6T4 | 87-439 | None |
| A0A4R8TBG3 | 276-651 | None |
| A0A833SSU0 | 14-393 | None |
| A0A1V8S7Q9 | 87-496 | None |
| A0A2T2MZ31 | 1-319 | None |
| A0A0B7FCQ4 | 354-742 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.