DPCstruct | MC44451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 606 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | PF19331- PF15697- PF18140- CL0105- PF02817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J4U7K5 | 8-111 | STSFTSAPVVVEVPQMAESITEGTLKQFNKEVGDFVKADEEIATIETDKIDVSVNAPQSGKILKFLANEDDTVTVGQALVELEPGEA… |
| A0A1B3SL93 | 3-80 | KVKFKNSRKYKGIVESVLVSDGQPVKAGDLLAKVSTQVEKFEIKSPINGYIRNIYIIESLIVSHGDTLFDVINWRELD |
| A0A2J8AFC0 | 21-147 | None |
| A0A1B0BUA5 | 65-148 | None |
| A0A7S2UBK6 | 455-539 | None |
| A0A6D2HY35 | 502-602 | None |
| A0A7S0YMC2 | 46-167 | None |
| A0A1C3K3F6 | 132-242 | None |
| A0A7R8X7K2 | 314-392 | None |
| A0A6V8DAA4 | 324-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.