DPCstruct | MC4445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821XUC1 | 59-153 | LTGSYHNLFKITSRVTRKDAIFESSREQAIRPRQLLKAKKVMPSARRNRRDEINPDSLEFSKKILHCAYHPTDNIIAIATAHNLFTY… |
| L9KUQ6 | 389-478 | MTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQD… |
| A0A446PSB6 | 44-138 | None |
| A0A804I6P1 | 68-174 | None |
| A0A817HC12 | 260-342 | None |
| A0A7S1HIY3 | 204-290 | None |
| A0A674AND0 | 261-357 | None |
| A0A397YZ36 | 103-198 | None |
| A0A816H4A6 | 137-233 | None |
| A0A1V9XMI3 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.