DPCstruct | MC44448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 161 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.64 |
| Pfam Score | 92.73 |
| Assigned Pfam label(s) | PF03460- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9F6L3 | 17-178 | SKGDIIQAVNKGCHTVAALKAETKAGTGCGGCIPLLTQVLNAELSKQGIEVNHHLCEHFAYSRQELFHLIRVEGIKSFEALLTKYGK… |
| A0A0B8PBW1 | 21-166 | GDIKQAVASGCTTMAELKETTNASTGCGGCSALAKQVLDSELLSLGVEVNNDLCEHFAYSRQELSDIVRINQIKTFDELLEKYGSGL… |
| A0A378A120 | 268-425 | None |
| A0A7Y3J0M4 | 404-574 | None |
| A0A1F2RU33 | 2-196 | None |
| A0A0K2RHP0 | 2-157 | None |
| A0A377DLR7 | 243-391 | None |
| A0A261XZX7 | 475-627 | None |
| A0A6I1ISC8 | 1-155 | None |
| A0A011P3X0 | 8-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.