DPCstruct | MC44446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 57 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.63 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0111- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PAY7 | 2-46 | TNILAQLSELTTIVADTGEIEAIKKYQPQDATTNPSLILKAAQLD |
| A0A6D0ER39 | 2-60 | TDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPEYRKLIDDAVTWAK |
| A0A447LTJ5 | 1-44 | None |
| A0A5F7ZK12 | 236-303 | None |
| A0A1X2I0A2 | 25-76 | None |
| A0A6I4KNJ2 | 1-50 | None |
| A0A6G0TXR1 | 1-71 | None |
| A0A3S4U4H9 | 1-38 | None |
| A0A379UZY2 | 2-60 | None |
| A0A377ZAU1 | 1-37 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.