DPCstruct | MC44445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 110 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12294 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PA92 | 22-114 | LVLDPIYKDTDIEKQANNLGVDVRFHMGFRLKVSTLDQHHDYRGEEFVNLAHKIAEDGVIHPLLLSKAIYEDGYDEQDVKKVWHYLA… |
| A0A7X0UCS1 | 90-191 | HGPVLLARDVEALVLDPCFRESPLEELARQLPCPVEWHAGFRLDVEVLLQHADYRGSAIAALGAQIARHGVLTPAAIGEAAASGQHD… |
| A0A329QWR5 | 45-170 | None |
| A0A543N518 | 129-218 | None |
| A0A840W2C7 | 204-298 | None |
| A0A0N0ARP3 | 166-262 | None |
| A0A7V6Y7M5 | 50-200 | None |
| A0A7W3SSW6 | 51-182 | None |
| F3ZAI6 | 385-476 | None |
| A0A562WFU6 | 3-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.