DPCstruct | MC44443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8NXS0 | 1-66 | MYANKPDTWDENLAGYERSRFIINAFTRMRYCYSDGRLDMDSKLPPEDVDKSVLIPWFELPERIEL |
| A0A336N7F3 | 59-116 | YSEQPDRWSPNLQGLDRLRYIVNAFTRMRFCYWDHRLDFACKLPIKDAPKNLAPWFSL |
| W1HSN6 | 283-343 | None |
| A0A379AMJ0 | 1-65 | None |
| A0A378BDN9 | 1-63 | None |
| A0A3S5DM18 | 6-73 | None |
| A0A090QVQ3 | 39-110 | None |
| A0A7R8ZU77 | 154-229 | None |
| A0A7H4M068 | 155-216 | None |
| A0A7R8W4F7 | 190-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.