DPCstruct | MC44440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3UB84 | 52-172 | MAPAGEFSFNANRTSPYSRYSISVQPLPWLESTIRYIAISNINYGDEGFSDQSLKDKAIDAKFRLWQESRWLPQVALGFRDIGGTGL… |
| A0A4P0YQR8 | 1-133 | MRASHRKVNSASTTGITIKYRFYSTSVALFPWLEGTIRYTDVRTRKYSQWEDFSGDQSYKDKSFDFKLRLWEEGYWLPQVAFGKRDI… |
| A0A3P5GUD2 | 50-158 | None |
| A0A3A0EVI0 | 45-158 | None |
| A0A521YZ20 | 45-157 | None |
| A0A432ZKC4 | 366-490 | None |
| A0A0M4T2A8 | 144-263 | None |
| A0A377DZ99 | 1-121 | None |
| A0A6N6XBX1 | 2-104 | None |
| A0A447PX65 | 293-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.